PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_8069842g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 500aa    MW: 55410.5 Da    PI: 5.3132
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_8069842g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.72.6e-132675148
                     TSSS-HHHHHHHHHHHHHTTTT..-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg..tWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l+ +++  G+   +W  +a+  g+ R++k+c++rw +yl
  MA_8069842g0010 26 KGLWSPEEDEKLIAYIANNGMVgcSWGYVAKQAGLQRCGKSCRLRWINYL 75
                     678*****************9999************************97 PP

2Myb_DNA-binding414.4e-1381124146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg ++ +E+ l++++    G++ W+ Ia+ ++ gRt++++k++w++
  MA_8069842g0010  81 RGVFSHQEERLIINLQSIIGNR-WSQIAAQIP-GRTDNEIKNYWNS 124
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.5822175IPR017930Myb domain
SuperFamilySSF466898.03E-2523122IPR009057Homeodomain-like
SMARTSM007179.6E-82577IPR001005SANT/Myb domain
PfamPF002491.8E-112675IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-202782IPR009057Homeodomain-like
CDDcd001673.87E-72975No hitNo description
PROSITE profilePS5129422.58476130IPR017930Myb domain
SMARTSM007174.8E-1380128IPR001005SANT/Myb domain
PfamPF002491.2E-1181124IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.1E-2383131IPR009057Homeodomain-like
CDDcd001671.05E-884123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 500 aa     Download sequence    Send to blast
MRCTLGQGQG IQEDFPLPPS KPKLRKGLWS PEEDEKLIAY IANNGMVGCS WGYVAKQAGL  60
QRCGKSCRLR WINYLRPGLK RGVFSHQEER LIINLQSIIG NRWSQIAAQI PGRTDNEIKN  120
YWNSTIKRKL KLKHHLSSST TNCNTNDKSN IHSQSDRISN TNSVFSHANY ALTSSDSSQP  180
YLDAMPEGCQ TANNTLNVVT PGENQFRVAD VLELKQEQVQ DQSDEINQLV SYFETWINDT  240
STHTHQSVSS HEAFISPSLQ TQGLHTYNTA KSSTCDELII DACSTTVQPL EASASANYSL  300
VSTGITIPAV FGRECLKAKN ENDGWSTSHS YSSADDWSHV VDPGAYITHE AGISIVEEYK  360
SLYEKNTHQS WPLLSFRSQF GEPEIKCPRG QSNDFKAADD CKDSLDFIYD VNLGIPKYIG  420
NCSRQKSYQL PQIDGGEGDF KIISHEEPKA NPTPTILAGG SAPLEIECKG VAGQVTVWVD  480
DDIYSLSTAA ASDLDEIYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27221303108B-MYB
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT1172310.0BT117231.1 Picea glauca clone GQ03815_G02 mRNA sequence.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01680.32e-50myb domain protein 55